SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8BR80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1I8BR80
Domain Number - Region: 73-127
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0981
Family Mitotic arrest deficient-like 1, Mad1 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I8BR80
Sequence length 142
Comment (tr|A0A1I8BR80|A0A1I8BR80_MELHA) Uncharacterized protein {ECO:0000313|WBParaSite:MhA1_Contig42.frz3.gene2} KW=Complete proteome; Reference proteome OX=6305 OS=Meloidogyne hapla (Root-knot nematode worm). GN= OC=Meloidogyne.
Sequence
MQHLLTPSTSSLFPPHQTQNQQNLNFQNFNHLPPSLLVALQHKMAYAKQQQLYLNNQQNQ
QNCLKRIQQQIIIQNGEEKHEEKKSEKNLENSEKQIKEEKNILEEKTTKTHLQQQQTFKT
TSPVQFVSKRFQFDVNSLLEKS
Download sequence
Identical sequences A0A1I8BR80
MhA1_Contig42.frz3.gene2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]