SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8C9J5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8C9J5
Domain Number 1 Region: 72-201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000181
Family Motor proteins 0.018
Further Details:      
 
Domain Number 2 Region: 7-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000418
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I8C9J5
Sequence length 225
Comment (tr|A0A1I8C9J5|A0A1I8C9J5_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:RSKR_0000176000.1} KW=Complete proteome; Reference proteome OX=114890 OS=Rhabditophanes sp. KR3021. GN= OC=Panagrolaimomorpha; Strongyloidoidea; Alloionematidae; Rhabditophanes.
Sequence
MSEIKSEKYKIPTSLRPLLEAVARETIRAQPDDVVAFGKLFFDLLTEHQKDSDEDVISDN
IAYGMFRMDLQQRFKLMSSKRGNYRPASPQDIAATKIQAIFRGHQVRSHPEKFGLDSDIL
RRRSSDRLSKMDNKKDVKRHSIGGYSLENSETPEDRAATKIQAQLRGFLARKNVTAMKEK
NENAATKIQAHIRGFLTRKRLGEEGLLSPSRSRSSLQSHKSDDIN
Download sequence
Identical sequences A0A1I8C9J5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]