SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8CHW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8CHW0
Domain Number 1 Region: 197-223,254-527
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.21e-49
Family Ankyrin repeat 0.00075
Further Details:      
 
Domain Number 2 Region: 699-916
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.88e-37
Family Ankyrin repeat 0.0009
Further Details:      
 
Domain Number 3 Region: 534-735
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.02e-29
Family Ankyrin repeat 0.00045
Further Details:      
 
Domain Number 4 Region: 939-1000
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.63e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00071
Further Details:      
 
Domain Number 5 Region: 36-90,146-223
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000000628
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I8CHW0
Sequence length 1005
Comment (tr|A0A1I8CHW0|A0A1I8CHW0_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:RSKR_0000495600.1} KW=Complete proteome; Reference proteome OX=114890 OS=Rhabditophanes sp. KR3021. GN= OC=Panagrolaimomorpha; Strongyloidoidea; Alloionematidae; Rhabditophanes.
Sequence
MLRSCMGKTYIGVTLETAKIVVKWMYTDEVENDLSVEQFMELLLVSNQFALIVLKEFCES
ALMARLDTDNCIKIYQFSQDSNLDKLKKHCIQLMNERWDDFLPEHFVSLQPKLLFDLLKG
HSTSVLASIIRLQRQDVLFLFLLENGNRLKEVINAFTEKNDLPLGLALNSRQFEMAKELV
KNEANVNACYKDGKFLLFEAIEKDNIEGVEFLVANGVFLGAVQPETNFTLLHTFASSTKM
TDNMVEWATSQINEMDFVNQLDNIGRTPLSIAMTKGNEPIIELLLKNDKCDVNIATIEKV
TPLQICLFERKDMLRSKLLVDKGANVNFKDKNGESLLHLAVIKMDLIVMKFLIDNGADIN
SKNSDSLTPLHLLISRKDQFDFKVVSGALNLLVTETANLFIQDDVNGNTVLHLAVSDVRI
LESFEGNNLPLAVKNFHGETPLAVALKNCHFDCGKWLVKSGADIDEKDTEHRTLFIQALE
SKNEEMAMFLLQNKASLVAVNKDELTCLEIAVDNNLSNVVEAMCHVGIKINSLNATTGLS
PLWRALEREHMEVAEILVNHGCDQSLLHRAIDNNNVCAAKFLINKNADVNALKKYYDSAN
DDKQNSLHMAIAYGLTDISLMLIANPDMKYGAPDGDGKTPAHLAIQEEDTEILRILLSTH
DVSFLNARDKLGMTPLALAMKRKNVFAAKEIVNRLPHAAVQVNGNGENLLHVAVKNDDFE
SVLFLLSLQIDVNIVTQDKFKFTALHLASQIGSEMIIRNLLLAGARINTVNSKGLTSIHI
AAFHGHALALQILISNEAECNIVDIESNSALHSAVIGESEEAFKVLLMESQINPYIQNIF
GQSCLHLMTGISSKTSTTMFNCLIQNFPDFPLEAADGDGNTAFLLAYHHGNGELCRALIK
QNVCIAITNAHGMSIFSIETPTKQLLYGLLDNLKSEPKWSEGDNCSDCKTKFTLTMRKHH
CRHCGRLVCSKCGDQTMPLIKYGIQKPVRICKICQDALVNGVPRN
Download sequence
Identical sequences A0A1I8CHW0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]