SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8D4S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8D4S4
Domain Number 1 Region: 578-774
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-19
Family Nucleotide and nucleoside kinases 0.00049
Further Details:      
 
Domain Number 2 Region: 153-338
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000387
Family Nucleotide and nucleoside kinases 0.0011
Further Details:      
 
Domain Number 3 Region: 4-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000115
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I8D4S4
Sequence length 784
Comment (tr|A0A1I8D4S4|A0A1I8D4S4_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:RSKR_0001161700.1} KW=Complete proteome; Reference proteome OX=114890 OS=Rhabditophanes sp. KR3021. GN= OC=Panagrolaimomorpha; Strongyloidoidea; Alloionematidae; Rhabditophanes.
Sequence
MGSESKRYLQDNHIPQLFEGLMTGLIYNKPADPIIFLEDCLKQIKHNPSLALKWNAFVDE
KNQAFVKPAAYPLMISKRHNETVNHNDTTARKSASSSANNKGPPLNENENVEVIEHNSGV
DRKSSLLESPKSNRERSSSVMRAAESAKIPEVPVILFMGGPGGNTKTRHATRIRDKLEDK
GLVHICMPDIIKAAVSRYQDNYPEWANVAQILARREPIPNHLALQLIKAEMGRHQHASSF
LMEGFPREAKQVEDFESQVSPVHMALIVDYDEHILREHMERKGLFTSVIDSKINDFKQRT
LPTAKYFDDQGLLHLIPGESSDDEICDRLVDLITRLIDTGVPIFNHAYEESRNRREISDL
TNSKPESALNSAKSTRNHSLKGNSVAASPQIPIESGRMSREELAKDNRQIPESHNSMRNE
SRTSVPRDQSAKSVSGKNISRQESLKSQKNISSRETSATSHKLHKREVEPENINIKTESE
ESQMTRTTPENIGASNPQSKSHSPALEDIIVPVREPENGHKSKTPSPDKVNEVSSSHSKD
EDTNGVHDASDRLLSTTPSQISTATIVPIGDKISLDVPVILIIGPSGSNKYEISKKLSQK
YEGFVHLSMQALLRTKIKENLDDELWQRIGKKMNLGELIPMKICRELIYSAIQEHSSTSW
GFIIEGYPRSQPQMNDYENHGIRLDLAFLIDCTEHFCIENMTKRNADNASNPDRRLDDVA
EVMQTRLDHFKTNSLPMLKFLDDAGKLRVVRIEYKIDGDADMDGLLNEITKIIDTTTFTN
HHND
Download sequence
Identical sequences A0A1I8D4S4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]