SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8EKM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8EKM7
Domain Number 1 Region: 59-113
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 7.85e-21
Family Nucleolar RNA-binding protein Nop10-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I8EKM7
Sequence length 120
Comment (tr|A0A1I8EKM7|A0A1I8EKM7_WUCBA) Uncharacterized protein {ECO:0000313|WBParaSite:maker-PairedContig_2705-snap-gene-0.8-mRNA-1} KW=Complete proteome OX=6293 OS=Wuchereria bancrofti. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence
MDFAHSKTPLTKELLVILANSGGIGNFHKANLKVCPSGGRIYFFWDCGIVEYLVCVMYLK
FYLDEEGNRVYTLKGIDPQGRQTQSAHPARFSPEDKNSKYRIIIKKRFNILPTMQPKPVY
Download sequence
Identical sequences A0A1I8EKM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]