SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8FF44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8FF44
Domain Number 1 Region: 105-225
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.98e-27
Family cAMP-binding domain 0.0000414
Further Details:      
 
Domain Number 2 Region: 403-512
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.27e-19
Family Motor proteins 0.0015
Further Details:      
 
Domain Number 3 Region: 248-297
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000123
Family cAMP-binding domain 0.0012
Further Details:      
 
Domain Number 4 Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000327
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I8FF44
Sequence length 515
Comment (tr|A0A1I8FF44|A0A1I8FF44_9PLAT) Uncharacterized protein {ECO:0000313|WBParaSite:maker-unitig_32481-snap-gene-0.2-mRNA-1} KW=Complete proteome; Reference proteome OX=282301 OS=Macrostomum lignano. GN= OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
MSVIIPDGFTQLLQEFTVAVLRTRPPNLIEFAAAHFRRLEQLQQQHGTASKVQFQPAQEQ
QRGATPNLTPKTKRPEKTRTTRKSVAAPSFDPEQHEATYERRVVPKSDEQRRRLMEAMRH
ILLFRSLERADLGHVIDAMEERLVSAGTCVIEQDQEGDNFYVVEKGIFEAFVRDRATGTS
RHVLTYKNEGSFGELALMYYCPRAATIVAKTDGVLWSLDMETFQQKVLMAAFKHRKNLSS
GRAAAGREMTQYERQNVADALREREFSDGEPIILQGDVGNEMFFIEDGSVRVMRRHNAAD
SGLETQSPAATPWAPRAVCVLHVSDFERLLGPCLTVMRRNIDAYKRQLAEIFGGDEASVP
LPRADWQRTGLSINLQRVAGLTLSSVLIETAGPYTRISQPPDEAMNIDVIGRVRPSIRNE
GPCTLAIGSDNRVSSRPGGQSFVFQHLYQQGSSNLDVYSRHVEPMVDIFLAGYNVCFMCF
GESGSGKSFTLAGDSSMKNGLVPLVLASLFCQAGP
Download sequence
Identical sequences A0A1I8FF44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]