SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8FMZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8FMZ6
Domain Number 1 Region: 3-181,213-271
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-34
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 294-359,414-438
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000196
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I8FMZ6
Sequence length 963
Comment (tr|A0A1I8FMZ6|A0A1I8FMZ6_9PLAT) Uncharacterized protein {ECO:0000313|WBParaSite:maker-unitig_41382-snap-gene-0.2-mRNA-1} KW=Complete proteome; Reference proteome OX=282301 OS=Macrostomum lignano. GN= OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
MRVLIDCGADLNAANSLGDTPIYQACLEAAPYLNLPNASGITPLMIACFTGAEAVVELLL
RYGARVDCRDVAGKTAAHYCCPARALDCLRLLVRAGVPLEADGSDGTSPLMEAAYQGASD
QLLDLLLSAAPESALAARDCRDRGALFYAIEGGSLPTFQRLLRAGASTRAAQPSGVTLLM
TAALRYRRRLAELLVDLLRNEADRRDDEDSDGIRARDAEGRNALFYCVANPEPDLLQLLL
DSGLPAEKATDGSTLLMACIARRNWTLVDFLLRRADSLAPLVDLAAVDSAGESALTLAVR
AQNQQLLHQLIGMGGAAVTDGENFPKRWRRLLQLACQCGNAEAAMLFAEMAKPDDLAVAV
RGGDADGEGEGEGEGDDGLLFFCVRGGHVDLTRHFLRLLRGTATAAALADGTTAAGGKNL
FHEACATGRLAMVQMLMQELPEQQILLKDAQGRNAYFYARAERGSATSSTCSMARRGLEP
TPDNRGRHPADAGAGSGGSGGQSGGAAAAAVQPRPLRPDRIRRRLRRSRRGFLRGRVGQL
ARLVEDLLTRAGTSEEPRDKGRAGLCSCTAPPAAPPQCAKQLASPRSRELLRIEPGSWMP
TARTRCSTRGAGAQLRVGGRLCSSAAAWRRRRIRAPVDSGTGLRHRTGPPGRAAAHHTPA
CRRGRPADGCDDAAVHPASSTSSLSRRVDHLARLAGLPTRAWLKLLLEAFNGLDVGRCGR
MLPAAKDGSTLLHLGARSGNVQVFMHLLRFFVPSGSQQEAAAMLNARDANGTSVAHILPL
PERPWCSASCWNRRADPQAADADGSARCTWPYRARAPSKAVRAGCWTGALTPSSRLAPGP
TRSSFVRQNPRRRRCWWQDCLQLLESLFQLDQSQRETIEAYSKRLGEVDLAELASQMAKR
DVILVMELMNQRAERRDYMLSLVISSGQNSNSGLPHRVKAVQSQVAMELRAKLFVKPESE
FMV
Download sequence
Identical sequences A0A1I8FMZ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]