SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8G619 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8G619
Domain Number 1 Region: 422-471
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000929
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I8G619
Sequence length 1269
Comment (tr|A0A1I8G619|A0A1I8G619_9PLAT) Uncharacterized protein {ECO:0000313|WBParaSite:maker-uti_cns_0000986-snap-gene-1.14-mRNA-1} KW=Complete proteome; Reference proteome OX=282301 OS=Macrostomum lignano. GN= OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
MEDAELYQDCLSGAPSTVLTESVSSSSRSSSNDKWIERNISKLECVRFTPVAADLAKCQC
GKPLSEHPHGLPRSTTAWASASHTEASPTDAYGVIEFVSGPHPTRAHYIRVAANTQPEQL
LHILTRVWRLRLPKLVLTVHGGIQNFELQPKLKKVVLNGILKAAKTTDAWVISTGLDNGI
SRYVGESISEEIHMKKHRIAAIGIAPWGVIRDREQLIGRNRTCKYFAISSSSKALSVLNR
CHNYFILVDDGQSNVYGTEIQLRRAFERHLCSMRLDKSRFGVGLDRVPVVATLIEGGANV
FRHVLDLTLDRRPIPVVVCDGSGRAADILAFIHKNGEQVLNCTALADQIVDLIRDKFRLA
RSKALAVFSEIRVCLQGPGRDLVSVFRLGEGRFKDVDDAILTSLLSSHHLSHSSQLKLTM
AWNRVDLARSHLFQYGQDWRSADLERAMMEALMNNRIEFVKLLLEWGVNVERFLTRLRLE
DLYTFCLFGDETKGLGKYLRFLLKQTLAKFSKKQQRVSLYLIGRLVQELIGGGFVHEYTR
RFCLAKAAVRSASGALPPDAAAGATGGLASEQPTITGAASNTLMNSIKSCGEDVIAKALF
SAALFRAIMTRIDEDVHVEYYQELESWCDKYEAEALSMLEHCYKFDPRLTRKLVTYQLAE
FGGHTCMSLAYTSRSMLFLNHACPQIILNDLWYGGVRETDDLTGLRVFALCLVLLACPPL
FFALLLFTNFVEFKSLQELRDQPQTRDEFGDVESSSSSSSSSGSSVSSRDAEAKAHRVEQ
QADQHQASAAAGAAPASSLRNFMRQVPEESLSDKIDRLGLQSGGSGQANAKKSGGRVNFV
NELPMTTIVAPQAQQHAGKTAQLPRIGSSGGGRAGASSSLHFPMKDSEYSGYQNYHTRGP
QPQHSRLDRLPYRMRVSEFFSAPITRYWIHLITYAIFIVSFFSYVLVVLPESRFVWQEYL
VFAYIVSYALDKVREISNCNGLTLRVKLQVHLSDLWNIYDLCICAFSLVGIALRVASVHS
VNGAAADNSSFVGFYTNYSLLLLGNGSGLGDAHSEFARQFYVFFCSHNIMVISLALWLLR
IFEVLINWKHLGPYLYMVATMISKMLPPVVIIFIPLCAFGIVRQGIQYPQYNTFNITVLK
GVLLKPYFMLYGEVYAGEIDPDEWTGLESLMPLRCVVPIAMVIFLLVAVIVCISIIIAVF
NDVYHEVHEKSKQVYKYLRFSIIIEYESMPMFPPPLTLVSWIFLTVRWLYHKRCRFWGCG
GGGGGGGGG
Download sequence
Identical sequences A0A1I8G619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]