SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8GI46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8GI46
Domain Number 1 Region: 152-272
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-31
Family cAMP-binding domain 0.00000211
Further Details:      
 
Domain Number 2 Region: 281-401
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.68e-30
Family cAMP-binding domain 0.00000346
Further Details:      
 
Domain Number 3 Region: 10-55
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000000353
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I8GI46
Sequence length 414
Comment (tr|A0A1I8GI46|A0A1I8GI46_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA93613.1, ECO:0000313|WBParaSite:maker-uti_cns_0001963-snap-gene-0.3-mRNA-1} KW=Complete proteome; Reference proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig016081g2 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
MNTSAEEAHLKDVESYLEKHGVQKVLKECIVQLCTVQPDNPFEYIKEYFDKVDKDRILMP
DQFATIGAGSESLASSALATGTSRALASTAGAVLPMPGTEGDVDYDSETMLPPMPAAAAA
PQSQKQRTRRGAVSGEVYTEEDAASYVKKVVPKDYKTMGALSKAITKNVLFSHLDENERS
DIFDAMFPLHRNADEVIIEQGAEGDNFYILDQGEVDIFVNGDYISTVSEGGSFGELALIY
GTPRAATVKAKTEVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSKVPILENLDLWERLTV
ADALENVTFEDQKIVVRQGEAGEDFFIILEGVASVLQKPSENDEAVEVGRLGPSDYFGEI
ALLLDRPRAATVIARGPLKCVKLDRKRFERVMGPCGDILKRNIAKYNSYILLTV
Download sequence
Identical sequences A0A1I8GI46

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]