SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8IJL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8IJL4
Domain Number 1 Region: 118-238
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.69e-28
Family cAMP-binding domain 0.0000459
Further Details:      
 
Domain Number 2 Region: 259-355
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000223
Family cAMP-binding domain 0.00082
Further Details:      
 
Domain Number 3 Region: 11-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000418
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I8IJL4
Sequence length 372
Comment (tr|A0A1I8IJL4|A0A1I8IJL4_9PLAT) Uncharacterized protein {ECO:0000313|WBParaSite:maker-uti_cns_0012990-snap-gene-0.1-mRNA-1} KW=Complete proteome; Reference proteome OX=282301 OS=Macrostomum lignano. GN= OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
GQASKSQTDYSRCLQDFTVSVLRRRPTNLVHFAAAYFRRLDLVNSAVEGDAVAVLTVPAR
EDSGAETDDDLDIAAAAAAAAAEAGKVPPWRANRRPSVAAPSFDPEKSEATYQRKIVPKS
DEQRRRLTETVKHILLFRSLDRVSLSHVIDAMQELSVKAGDMIIEQDQEGDNFYVIERGI
FEAYVTDSVSGERRLGVTYNHSGSFGELALMYYCPRAATVIAKTDGVLWSLDLDTFQQKV
LMSAFKNRKKYEAFLAAVSLLSELTHYERAECEPILFQGDPGNEMFFVEEGSVKVMRRHS
DNGLETQPRAASCYSVGRTRVCVLHVSDFERLLGPCLEVMRRNIDSYRSQLREIFGDATS
AAAAPLRVEASV
Download sequence
Identical sequences A0A1I8IJL4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]