SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8NC07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8NC07
Domain Number 1 Region: 38-72
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000915
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I8NC07
Sequence length 141
Comment (tr|A0A1I8NC07|A0A1I8NC07_MUSDO) Uncharacterized protein {ECO:0000313|VectorBase:MDOA013668-PA} KW=Complete proteome; Reference proteome OX=7370 OS=Musca domestica (House fly). GN=101900984 OC=Muscoidea; Muscidae; Musca.
Sequence
MDFPKSCRQTNWSSESLKNYTSIESIRRHLARGNSSYLCRHPEVRAIIRVFLHELLDKQP
ENIYEFSAALFNCNNSLLLVNKINKQLNLVDRASKRNKGSENVAEEIFPKTTSTDSLLSR
ASTSADIDAMLRYAMLLRDDK
Download sequence
Identical sequences A0A1I8NC07
XP_005189860.1.65292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]