SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8PGG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8PGG5
Domain Number 1 Region: 110-229
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.24e-33
Family cAMP-binding domain 0.0000194
Further Details:      
 
Domain Number 2 Region: 233-356
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.19e-29
Family cAMP-binding domain 0.0000842
Further Details:      
 
Domain Number 3 Region: 6-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000012
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I8PGG5
Sequence length 381
Comment (tr|A0A1I8PGG5|A0A1I8PGG5_STOCA) Uncharacterized protein {ECO:0000313|VectorBase:SCAU007822-PG} KW=Complete proteome; Reference proteome OX=35570 OS=Stomoxys calcitrans (Stable fly) (Conops calcitrans). GN=106086141 OC=Muscoidea; Muscidae; Stomoxys.
Sequence
MSNEQKQRIQVPDALREVLLDFSIAYLLEQPGDVVDFAVEYFTKLQESRRQTSFSRDNDR
GSVDDSVMSQEDDDEPVVPRFSNRRKSVFAEAYDPENDADDDEGATAVFPKSDEQRARLI
ESVKNVLLFRSLEKEQMNQVLDAMFERRVLPGENIIRQGDDGDNFYVIESGVYKVIVNDN
HVHTYTNSGIFGELALLYNMPRAATIQADSEGLLWAMDRQTFRRILLKSAFKKRKMYETL
LDSVPMLKTLQSYERMNLADALVTKRFNTSDRIIKQGDVADGMYFIEEGTVVIKMDQDGS
EIEISKLGKGAYFGELALVTHRPRAASVYAASDDVKVAFLEVEAFERLLGPCMDLMKRNI
DDYETQLIKIFGSKNNITDTR
Download sequence
Identical sequences A0A1I8PGG5
XP_013106135.1.53170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]