SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I8PPN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I8PPN9
Domain Number 1 Region: 67-171
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 4.58e-27
Family Steroid-binding domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I8PPN9
Sequence length 234
Comment (tr|A0A1I8PPN9|A0A1I8PPN9_STOCA) Uncharacterized protein {ECO:0000313|VectorBase:SCAU010007-PA, ECO:0000313|VectorBase:SCAU010007-PB} KW=Complete proteome; Reference proteome OX=35570 OS=Stomoxys calcitrans (Stable fly) (Conops calcitrans). GN=106082442 OC=Muscoidea; Muscidae; Stomoxys.
Sequence
MTSDTMDHQNSETESTSMFMSIVQEIFYSPMNLALVAIIAFLVYKIIKDRIEVPSAGSQR
TPEPELPKLRRDFTVAELREYDGNQPDGRVLVAVNGNVFDVTKGKRFYGPGGPYASFAGR
DASRNLATFSVTANDKDEYDDLSDLTAMEMDSVLEWEMQFKEKYTLVGKLLRKGEQPTNY
EDEEEDTDKDCKPTDISSDSAAVAKSATVSSNSPTVDNDSMRKRNTTLPIEEVD
Download sequence
Identical sequences A0A1I8PPN9
XP_013100400.1.53170 XP_013100401.1.53170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]