SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J0UIA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J0UIA1
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 0.00000000000000288
Family PG0164-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J0UIA1
Sequence length 96
Comment (tr|A0A1J0UIA1|A0A1J0UIA1_9MYCO) Uncharacterized protein {ECO:0000313|EMBL:APE19488.1} KW=Complete proteome OX=1920667 OS=Mycobacterium sp. WY10. GN=BOH72_27360 OC=Mycobacterium.
Sequence
MDWEFEAEVFQWRGPAPYFFVETPAHVDDFLHAHLGELTYGWGVIPARVRIGGTEVTTSL
MPKEGVYLVPLKVALRRPEGIDDGDHVLVRLQVGRT
Download sequence
Identical sequences A0A1J0UIA1
WP_071950324.1.2103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]