SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J1CX92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J1CX92
Domain Number 1 Region: 30-100
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 1.31e-24
Family Hypothetical protein YwqG 0.00016
Further Details:      
 
Domain Number 2 Region: 2-38
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 0.00000183
Family Hypothetical protein YwqG 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J1CX92
Sequence length 100
Comment (tr|A0A1J1CX92|A0A1J1CX92_CLOBO) Uncharacterized protein {ECO:0000313|EMBL:APF26985.1} KW=Complete proteome OX=1491 OS=Clostridium botulinum. GN=NPD7_916 OC=Clostridium.
Sequence
MKKFTGEIEKTIKPYIKIKLEEQKTMPWESKLGGYPAFTQCDPRYYDKNLERFNTLLLQL
DCEDECDLMFGDAGVANFFINEEDLKKLDFTKVLYNWDCC
Download sequence
Identical sequences A0A1J1CX92
WP_080333533.1.100330 WP_080333533.1.6815 WP_080333533.1.84758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]