SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J1GYT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J1GYT1
Domain Number 1 Region: 26-64
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000012
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J1GYT1
Sequence length 67
Comment (tr|A0A1J1GYT1|A0A1J1GYT1_PLAGA) Uncharacterized protein {ECO:0000313|EMBL:CRG97724.1} KW=Complete proteome OX=5849 OS=Plasmodium gallinaceum. GN=PGAL8A_00530100 OC=Plasmodiidae; Plasmodium; Plasmodium (Haemamoeba).
Sequence
MEKDFNLIEKNNLNEEINNLKNENIKYMETHQELKDLLNDFISSILLHTPDDIFKYANEY
FSYFKKN
Download sequence
Identical sequences A0A1J1GYT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]