SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J1IBD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J1IBD5
Domain Number 1 Region: 105-226
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-33
Family cAMP-binding domain 0.0000104
Further Details:      
 
Domain Number 2 Region: 237-364
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-30
Family cAMP-binding domain 0.00005
Further Details:      
 
Domain Number 3 Region: 3-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000994
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1J1IBD5
Sequence length 377
Comment (tr|A0A1J1IBD5|A0A1J1IBD5_9DIPT) CLUMA_CG010931, isoform A {ECO:0000313|EMBL:CRK97544.1} KW=Complete proteome; Reference proteome OX=568069 OS=Clunio marinus. GN=CLUMA_CG010931 OC=Chironomidae; Clunio.
Sequence
MSKQKVKVPDSLRDVLLEFSIAYLLEQPGDVIDFAVDFFTKLQTNRAQTGIGIGVTKPTT
PDESIISQDEEPVVNRFAGRRKSVFAEQYDPEEDEEEENNKVIFPKTDEQRSRLCDSVKN
ILLFRALDPEQMNEILDAMFEKKVKPEDVIIRQGDDGDNFYVIESGIYNAYVGDDNKHVH
TYENRGSFGELALLYNMPRAATIKAVSEGQLWALDRQTFRRILLKSAFRKRKMYEALINS
VPMLKTLQNYERLNLADALIPKVFGAGERIIKQGDAADGMYFIEEGTVSIKILQDAGEVE
ISKLEKGQYFGELALVTHRPRAASAYAQDNVKVAFVDVDAFERLLGPCMDIMKRNIDDYE
SQLVKIFGSKSNIADIR
Download sequence
Identical sequences A0A1J1IBD5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]