SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J1IMU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J1IMU0
Domain Number 1 Region: 65-185
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000239
Family Fungal lipases 0.041
Further Details:      
 
Domain Number 2 Region: 839-1000
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000239
Family Nitrogenase iron protein-like 0.085
Further Details:      
 
Domain Number 3 Region: 1177-1270
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000314
Family Pseudo ankyrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1J1IMU0
Sequence length 1313
Comment (tr|A0A1J1IMU0|A0A1J1IMU0_9DIPT) CLUMA_CG014684, isoform A {ECO:0000313|EMBL:CRL01480.1} KW=Complete proteome; Reference proteome OX=568069 OS=Clunio marinus. GN=CLUMA_CG014684 OC=Chironomidae; Clunio.
Sequence
MFIKTPFENQVNAVNETLKVDNKLQLSHQNFIDDIREQLKIRKISLIERLKHIQEFPTTH
VLADLSWKVYEDQEKEKLPDGWKLLTTAQNKEISNGYFGAAFLNPESQHCVVSHRGTELS
NFGSVLTDITGILFNNYAGQMDSACTFATKVADALKIIESESEDTHFELFFTGHSLGGYL
AQITNFSNAFLKQNEETFKRREPNDGEPFHTFAIVFDSPGSLPMLMKMKSKFETSDDPIC
LEDLSITSFLSAPNQVNTCNEAFGKVFRIFIDTSKMNFMDRNIGYTLTMHSIENIVKFFG
SHDEDQVQEVLEWPLREGITGIQELEKFLKYANYRNHYHIRGTIKEASKKIYVRYKTRKF
NRTSKPFSVFSRREKMFLEHFRWLKNLAEYASFNEYFDEIKDCEEIFKKLKSFDIIDQDI
HFKRSEEIKYFIPLIKIFLKLFPNIVEKARKFLIDPQIRAKIFSFETKIGLKHKKENFLD
FKPSTINLVNIFNNQFSQVSIRNGKSYDGLSMIFNELERSSFKNKYSNDGILVLDLQRFT
IVNELIDVKEYLKSSQNNFLVIVHCEDNVEIIEDSRNPFKNLIDALNDHPEFKIIMIGGS
ENLHFNDICEQVKEKIPDGFYKVEKEISWNDLSKDSQKKILKKGINFQGRHETLENFEIE
NLNDTLMNHILNCEDLEVNVDPFMKNSFTVYTNDHEKKELKGKLLLESLENNEDVLFISG
IYNESFEKSSGEMKKILQVDNSNEESLVDHNIVINLERLNECKKKLQITTTVGTDKTLEE
FDEKCRNFFDNSNRIVHWIKIKDDKLTWRKSFNNSLYIERKLKTENRVINDKQLHDEENK
LIVLVGTNGEGKSATLTHLARGKSKKSWVIHRNFKDIPLDEMKGNELSLDSVATLISKAC
NYDEENHLQSFLLRQMLSNKTEKPITFFLDNFEDLNDKDRVKAVNLLKFIKDNTSCRVIL
TLPDNLINLFQELNPSSYTFERMERTDKVKLLKEFWRTQFSLLWGHKKCTEIFSEAKKSK
FNSFADILLEHLDSMINKKADEKVMGGPKQLKLLAEGFMEDFEKFVQISTLKQKIIEGLN
LKSIYMQYVNAKYELYVTTKAQVASIDQKSKGMWRSFQNISLDSFVPQDFLTKYELCSTD
YLIYQLTKNQSAPKLLKTFTGYILTDCKCEKIRKYLNTHEDLLPKCVAFEITDENVQSIV
GAPMITACTEGHENILKFLIELLRKKPQLNNVELIEDDSGKNALDYGIEYCHKACVKTLV
EFLMDFGNEENLKKSLQNINDNILERFANKAESEEYLEWFSKILIKNNVQKTF
Download sequence
Identical sequences A0A1J1IMU0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]