SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J3HB69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J3HB69
Domain Number 1 Region: 59-114
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 1.8e-17
Family DNA polymerase beta-like, second domain 0.0019
Further Details:      
 
Domain Number 2 Region: 3-55
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.00000000000000288
Family DNA polymerase beta, N-terminal domain-like 0.0012
Further Details:      
 
Domain Number 3 Region: 103-169
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000000409
Family DNA polymerase beta-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1J3HB69
Sequence length 172
Comment (tr|A0A1J3HB69|A0A1J3HB69_NOCCA) DNA polymerase lambda {ECO:0000313|EMBL:JAU65569.1} OX=107243 OS=Noccaea caerulescens (Alpine penny-cress) (Thlaspi caerulescens). GN=LE_TR2446_c1_g1_i1_g.6889 OC=Coluteocarpeae; Noccaea.
Sequence
DRRSFSYYKAIPVIEKFPTKIESVDQLKHLPGIGKSLTDHIQEIVTTGKLSKLEHFETDE
KVRTISLFGEVWGIGPATALKLYEKGHRTLEDLKNEDSLTHAQRLGLKYFDDIRTRIPRH
EVQEMEQLLQRVGEEVLPGADIVCGGSYRRGKPTCGDLDIVVTHPDGQSHKG
Download sequence
Identical sequences A0A1J3HB69

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]