SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J3IJT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J3IJT2
Domain Number 1 Region: 36-139
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 5.76e-26
Family Steroid-binding domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1J3IJT2
Sequence length 246
Comment (tr|A0A1J3IJT2|A0A1J3IJT2_NOCCA) Membrane-associated progesterone-binding protein 4 {ECO:0000313|EMBL:JAU79652.1} OX=107243 OS=Noccaea caerulescens (Alpine penny-cress) (Thlaspi caerulescens). GN=MP_TR20447_c0_g1_i1_g.58287 OC=Coluteocarpeae; Noccaea.
Sequence
MVSVRRFLLSPFAGVTLIVVLVAVYFRSSFNSPNHQAYQNRLFSAEELALYNGTDETQPI
LLGILGSVFDVTKGKSHYGSGGSYNHFAGRDASRAFVSGNFTGDGLTDSLRGLSSSEVMS
IVDWRGFYTRTYTPVGKLVGRYYDSQGNPTKHLKGVEAKASRGAQLMEKQKIEEAKQTNC
NSRWSQDEGGEVWCDIGVPRLVQRPLEIAITGSMSKRCVCFEEDQLDQSGLEIYEGCEPL
AKTCKV
Download sequence
Identical sequences A0A1J3IJT2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]