SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J4JTV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J4JTV2
Domain Number 1 Region: 26-64
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000111
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1J4JTV2
Sequence length 69
Comment (tr|A0A1J4JTV2|A0A1J4JTV2_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:OHT02467.1} KW=Complete proteome; Reference proteome OX=1144522 OS=Tritrichomonas foetus. GN=TRFO_30412 OC=Tritrichomonas.
Sequence
MSSQVPEIDPELLDEKLDQIRIENEKYLRRHPELNKMISEFMMALLKDKPKEVLPYAVVF
FTTSQVEPD
Download sequence
Identical sequences A0A1J4JTV2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]