SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J4JZ15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J4JZ15
Domain Number 1 Region: 119-241
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-32
Family cAMP-binding domain 0.00027
Further Details:      
 
Domain Number 2 Region: 244-367
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.73e-31
Family cAMP-binding domain 0.0000996
Further Details:      
 
Domain Number 3 Region: 8-42
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1J4JZ15
Sequence length 380
Comment (tr|A0A1J4JZ15|A0A1J4JZ15_9EUKA) cAMP-dependent protein kinase regulatory subunit {ECO:0000313|EMBL:OHT03728.1} KW=Complete proteome; Reference proteome OX=1144522 OS=Tritrichomonas foetus. GN=TRFO_06561 OC=Tritrichomonas.
Sequence
MQQARQTPEQYLEEKRIKQLLQRIVVSLLEARPENPESHIVTLLSSQPKNSEESEKWPTL
AGRSHEPVQKSAIGGGALATGRRQSAINPSVLLGGSVARRKAMSSKMTSSTNVEIRVVPK
DESTFAQLEESVKKVDLFSFLQDEQRRVLVNAMFPCQYNDGDVIIKQGDQPDNFYILNSG
KCRVLKKTGDREQQVAVLSPGHYFGELALISGSTRSATVVADGHVDCWAIDQTTYLGLLK
EGHDKKRQQYRALLKNLPFLKVLQDYEILLVADALCPVNPSKGEEVVKQGDKGDEFFIIL
QGECVVKKKEGDGEPKEVGRIRSGEYFGELALLNEAPRAATVIAGDNCKLVKLDRASFHR
LLGPCSETFTQNMKLYQSTK
Download sequence
Identical sequences A0A1J4JZ15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]