SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J4K837 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J4K837
Domain Number 1 Region: 405-460,536-698
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.45e-28
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 327-428,455-480
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000497
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1J4K837
Sequence length 705
Comment (tr|A0A1J4K837|A0A1J4K837_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:OHT07567.1} KW=Complete proteome; Reference proteome OX=1144522 OS=Tritrichomonas foetus. GN=TRFO_05212 OC=Tritrichomonas.
Sequence
MIYGHFSEIKPNNHRKSNSRLLMKKKGGKKKDAYQITPDDLFYTRELNNDEIIFKISPSN
YLIPSHNNFSPSLDFTIISGDIEYKTSLEFANTIPEIKKQLKKDPWLRRHKLKNPIDLSP
IIDLLELTPIPITLDNYESIISCFNSLKIKNVHNFIMSNVNSMNCTIQIFQEFNNEILLN
CDILSEILDLSEDNFNETLLDVVSSDLFKTPEVIANFITTAVRIRPENCKALAKFCIEIM
KKLDFWFLHIVIQNCDQKDTYFLLKLFQADQSDPYKEQFFKTLKYESQNIFTWFSPEFEK
FDNQKYYEQLKKYQLQFSQVKRGKERSLPNEKDIPESFQFFISNISKFYKNDWELHREIT
NCGRSQNKLASMIRNDDINDFQQEIFSASMTQQIPYSIFERSNFLNKSPYLIEYAAYFGS
MKIFKFLLLNTNKLFNSLKFAIIGNNIEIVRICHQNNCDLIKGLKTSIKYHRYEIFDWIF
SQIKCEHQEYKACIKYNNLYALRVFVGKGIILQESCYELASCNCCLVLLKILHAFGLVPN
EIIDCIIQSIKKGYHQTVEFFLQNFPKQCSQYNLSSLLYIPIEMNFPQVLKVMIDSGMFY
ININVPHLDDDTPLIIAVKKESLEMVEMILNEKNIDVNEVNGNNLTALMIACEKGNEKIV
KRLVEVPDIDLFLKKDSLTAAKIASNHGFFKIYSFLMEKMKKIQK
Download sequence
Identical sequences A0A1J4K837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]