SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J4KS00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J4KS00
Domain Number 1 Region: 304-361,457-557
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.14e-27
Family Ankyrin repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 257-263,320-337,369-422
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000628
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J4KS00
Sequence length 606
Comment (tr|A0A1J4KS00|A0A1J4KS00_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:OHT13874.1} KW=Complete proteome; Reference proteome OX=1144522 OS=Tritrichomonas foetus. GN=TRFO_15899 OC=Tritrichomonas.
Sequence
MDSDFFDDDDELNPKYYRKVNKPQAAPYNYILIIINKHEICCSMGVTEFSDILKNFYVTH
NYMTPYECEIPNIPEDFNYKILEHYFLNDEIKISNENVEPLIEISLALQMEKLYNEAVQA
KDKFSVLSDNLASSSDLNILLDLSNTFLNLNEENFQDSLFQILELLDIVNHLTCYRMLFN
SIYSRHQKIKLYLNFLISIDQILNDSNKPNFLSGFINYMESNYTSENKKNIVNIILIHLF
YLGCKIVQDKYVIFRYLKSLNLESDFMLNDSKNDDVADAIYNDDIEILQRIASDPSFDFG
GSVESNNFEICKYAQKSLFYISYSALFGSIKCFKFILMHLKSIPETTYKYAIIGGNAEII
RLLESESDRKSDLFKLTIKYHRDSIFEWLAEKDKFPMDDNYLKICVKYSNYRIIQYLAEK
YIDCTKLFYEACRLNDIGLIRVCFNIPLYKEIETLNQTDYLSPLIYACEYENIELFDFLV
KDKSAEFDCCDKDMNTPFHIACKKGNFQIANLLMKYSNPDFMAQNKYHTTPLHYVCCSGC
VEIAQMIFSNRRIDVNIYVFTIFSNSFLICVYEVLYWLLMKFLFNILYSFKKFAYLVFLF
VVNKVL
Download sequence
Identical sequences A0A1J4KS00

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]