SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J4N803 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J4N803
Domain Number 1 Region: 7-89
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 4.45e-22
Family PG0164-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1J4N803
Sequence length 91
Comment (tr|A0A1J4N803|A0A1J4N803_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:OIJ27658.1} KW=Complete proteome; Reference proteome OX=1844 OS=Nocardioides luteus. GN=UG56_006550 OC=Nocardioides.
Sequence
MSTPIDKTFTATLTQSEAKGGWTYVVTDWTADFFGTRGLVKVSGRIDDLPFQASFMALGD
GTHKLPLKAELREALGKSAGDSVTIHLTERR
Download sequence
Identical sequences A0A1J4N803
WP_045547740.1.10660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]