SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J4W0F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J4W0F1
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.06e-19
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0006
Further Details:      
 
Domain Number 2 Region: 80-175
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.64e-16
Family Cold shock DNA-binding domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1J4W0F1
Sequence length 206
Comment (tr|A0A1J4W0F1|A0A1J4W0F1_9ARCH) DNA-directed RNA polymerase {ECO:0000313|EMBL:OIO39775.1} KW=Complete proteome; Reference proteome OX=1805293 OS=Candidatus Pacearchaeota archaeon CG1_02_30_18. GN=AUJ61_03535 OC=Archaea; Candidatus Pacearchaeota.
Sequence
MFYLTEVEDYVRVDPKLFGLPTSDSVREQLDETYAEYYEKELGKVVAVVEVLNVGEGVII
PGDGAAYYRCDFKLLVWKPELQEHVYGKVSEITNFGAFIDLGSMRGMIHISQTMDDYVSF
SESGSLSGKSSGRVLKEGDLCVARIVAISHKGDEPKIGLTMRQPGLGKIDWIKEDKAKRE
SENKKVTKKEEGKSKEGKAKTGKGKK
Download sequence
Identical sequences A0A1J4W0F1 A0A2G9LYR3 A0A2H9Q0X3 A0A2H9QND1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]