SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J5JMF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J5JMF8
Domain Number 1 Region: 86-178
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.04e-18
Family Cold shock DNA-binding domain-like 0.00014
Further Details:      
 
Domain Number 2 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0000000000000128
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1J5JMF8
Sequence length 214
Comment (tr|A0A1J5JMF8|A0A1J5JMF8_9EURY) DNA-directed RNA polymerase {ECO:0000313|EMBL:OIQ05759.1} KW=Complete proteome; Reference proteome OX=1803514 OS=Candidatus Altiarchaeum sp. CG2_30_32_3053. GN=AUK59_02600 OC=Candidatus Altiarchaeum.
Sequence
MYYLITAEDFVRVPAARLGEDIEKVVYSELEKGLSKGIFEIEGNKGVMVAVEKIYDVGEG
KIIQGDGGVYFEVRFTVVAEIPANLECVKGFVRSIMDFGVFIEIGTFDGLCHISQIFDDY
GSYDGRNKMIVGKGTGKKLMSGDEVKARITTISWKDDVFNTKIGLTMRQPYLGKDEWIEI
DKKIHEKDEKMKEKESKSQKEEPRGKDEKKEKKK
Download sequence
Identical sequences A0A1J5JMF8 A0A2G9LKG9 A0A2H9M3X2 A0A2H9NCU4 A0A2H9PF43 A0A2H9RJA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]