SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J6JDW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J6JDW2
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily MAL13P1.257-like 0.000000000000693
Family MAL13P1.257-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J6JDW2
Sequence length 130
Comment (tr|A0A1J6JDW2|A0A1J6JDW2_NICAT) Uncharacterized protein {ECO:0000313|EMBL:OIT05249.1} KW=Complete proteome; Reference proteome OX=49451 OS=Nicotiana attenuata (Coyote tobacco). GN=A4A49_11265 OC=Nicotianoideae; Nicotianeae; Nicotiana.
Sequence
MKFRLKIFAKLENISFLRPYGGVDTVNMPYFFKMLCENCGAVTSEQCTFLNQKEYHNEKN
IIIVLRDFTMADSGAYSPLMVFDVDGAQIHKYVFNGGWEVKPINLVNGGFVGVGGSPPIV
KELNNRFVRI
Download sequence
Identical sequences A0A1J6JDW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]