SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J7GVG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J7GVG3
Domain Number 1 Region: 5-132
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.47e-41
Family Calponin-homology domain, CH-domain 0.0000399
Further Details:      
 
Domain Number 2 Region: 208-267
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 4.97e-18
Family EB1 dimerisation domain-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J7GVG3
Sequence length 294
Comment (tr|A0A1J7GVG3|A0A1J7GVG3_LUPAN) Uncharacterized protein {ECO:0000313|EMBL:OIV98273.1} KW=Complete proteome; Reference proteome OX=3871 OS=Lupinus angustifolius (Narrow-leaved blue lupine). GN=TanjilG_09907 OC=Genisteae; Lupinus.
Sequence
MATSIGMMDGAYFVGRNEILTWINNRLHLNLSRIEEAASGAVQCQMMDMTYPGVVPMSKV
NFDAKTEYDMIQNYKVLQEVFTKLKIPKRIEVNRLVKGRPLDNLEFLQWLKRYCESVNGG
IMNENYNPVERRRKGGKDRSSKSLKSSKSLPVNALNISGSGETHTLSPNKACGMVLGVFD
PKVFCIFTAVPKQLRSNRGAGVANSTAEVQTLSKQVTDLKLSVEILEKERDFYFAKLRDI
EILCQAAELENDPVSVAIKMILYAADANESALDEAQEYLNQTLNSVEAEEETEA
Download sequence
Identical sequences A0A1J7GVG3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]