SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J9QDK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J9QDK9
Domain Number 1 Region: 7-92
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 1.44e-19
Family Tubulin chaperone cofactor A 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1J9QDK9
Sequence length 120
Comment (tr|A0A1J9QDK9|A0A1J9QDK9_9EURO) Tubulin-specific chaperone A {ECO:0000256|RuleBase:RU364030} KW=Complete proteome; Reference proteome OX=1447872 OS=Emergomyces pasteuriana Ep9510. GN=AJ78_05409 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Emergomyces.
Sequence
MAPPSPLSIATSAVQRLVKEEASYHRELKQQEERIKRLEAEQPDEDEDGNRDYMLKQEHQ
ALEETRKVLPNMKQKILDSIAKVDHLLAEEGQKGMESNVGEINAAKEAISQAKTAVREVS
Download sequence
Identical sequences A0A1J9QDK9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]