SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1J9RS29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1J9RS29
Domain Number 1 Region: 14-164
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 3.01e-23
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00035
Further Details:      
 
Domain Number 2 Region: 359-493
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000034
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1J9RS29
Sequence length 580
Comment (tr|A0A1J9RS29|A0A1J9RS29_9PEZI) Flavo protein {ECO:0000313|EMBL:OJD30333.1} KW=Complete proteome; Reference proteome OX=236234 OS=Diplodia corticola. GN=BKCO1_6200018 OC=Botryosphaeriaceae; Diplodia.
Sequence
MPPTESARALRILVASSIPSPIEEPFLSTLVAQKNIAVRSIVDSAEWKTCTPYASIPNAS
TDRSQPCRPFSDHDDVHRTAAELCAWADLLVLAPMDANTLAKMLHGVTDSLILEILRSWD
VSKRTLLVLGMSTLMWENPMTKKQISKIRRKWNWVRVLHPLLWNFESKGKRYLPWEGREE
LMGAIQNQLDLMTLGQDVDVSMGQTPKTSLSLRPAAKSASPLPPEIWSMILDSTGDWELA
KRLNVYTTLATPQSWLRAASKEGPHSFMDRLEWAILTGTLGDVKELFDTHTAPQWLSSQA
VRIIMRFALIPLLNYLESNHKDLFWASFGHTFLPDKASAIFGRIEILEYWRTSPTFLNKE
HTVDAMDGASRAGFVHILEWWRNSGLPMKYSEAALEQASSRGQIEALEWWKRASMRDDGH
VRTSGDESETESSAPPTRKPLRLKPGKAISFATQAGSLSTLRWWVTSTIPFSHEDTVAKL
ASTHGHVDILDFWQLLHGEKMIYDNQVLVGATKMGHRDVLEWWKKSGLRVEYKTCDIEEA
LEDGVEGVKGEQVRRWWALNGLNLGVGTSEWMRTKVLNQS
Download sequence
Identical sequences A0A1J9RS29
XP_020126593.1.92931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]