SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1K9Y9H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1K9Y9H5
Domain Number 1 Region: 10-87
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 4.84e-18
Family Tubulin chaperone cofactor A 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1K9Y9H5
Sequence length 168
Comment (tr|A0A1K9Y9H5|A0A1K9Y9H5_PLAVI) Tubulin-specific chaperone A {ECO:0000256|RuleBase:RU364030} KW=Complete proteome OX=5855 OS=Plasmodium vivax (malaria parasite P. vivax). GN=PVP01_0205700 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MENTAAHLRLLKINHGAVRRLLKELTYYEKEEGDLRAKVSSLKEQNKPAADITRAQEMLK
ETERVVPHIRSSLQGSLKKLCSHIYEHFSSVLLTDEKTVQFCATHSEETLKEMLSTHYEE
ICKEVDALNETLGKVLLYMKQDALPVCTPPPSAAVPLSCDEPIECVDI
Download sequence
Identical sequences A0A1K9Y9H5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]