SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L0DPS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L0DPS9
Domain Number 1 Region: 78-238
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-22
Family Mannose 6-phosphate receptor domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L0DPS9
Sequence length 275
Comment (tr|A0A1L0DPS9|A0A1L0DPS9_9ASCO) CIC11C00000003801 {ECO:0000313|EMBL:SGZ54374.1} KW=Complete proteome; Reference proteome OX=45354 OS=[Candida] intermedia. GN=SAMEA4029010_CIC11G00000003801 OC=Clavispora/Candida clade.
Sequence
MVSRSGKRLLLMAVLALLVVVLLLVEQRQQKETQHNDLLTHIHDLMAKPDQSSDESAKQQ
NPAQKVPSPVEKEHKEPALDPCTAFSPHKGFIDLGGLSNVANEGKAVAWSTRGFDSGHNY
SIGVCLSPIKKLQDVRIRDDLNSSQVGAFYIDPESGEYVLMGEYSVAPEIRGNKLTLTYA
NGSFCEKVKYSNGERLRRKTILTFTCDREMLTKAHVSYVAAVDDCTYLFEIRSHFACPTA
AKADNLAVIWIFLLICMAALLVYFSGGFLYRHLKR
Download sequence
Identical sequences A0A1L0DPS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]