SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L0DXB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L0DXB6
Domain Number 1 Region: 22-178
Classification Level Classification E-value
Superfamily GINS helical bundle-like 1.31e-38
Family SLD5 N-terminal domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 184-235
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.00000111
Family SLD5 C-terminal domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L0DXB6
Sequence length 235
Comment (tr|A0A1L0DXB6|A0A1L0DXB6_9ASCO) DNA replication complex GINS protein SLD5 {ECO:0000256|PIRNR:PIRNR007764} KW=Complete proteome OX=45354 OS=[Candida] intermedia. GN=SAMEA4029009_CIC11G00000002180 OC=Clavispora/Candida clade.
Sequence
MDIDDILTEFETGARAATKEKSEDLNQQMVTAMLNERMAPDLLPYRHELMKEVLTKLLNQ
QQYLLDSYEYGDSNAESGVLNADFKLQLMIIETEIERLSYLVRLYVRTRLAKIDNFTIFY
INETSNEPQGAPSLMTDQEKSYMHKHFKILTQLYNNSFLKKFPEFLTFLDDSAGNQNMIT
TPELNQPVFIRVIRQKPIILNLGHEGELELVHKGVYVVIYRLIKPYLDLGEIELI
Download sequence
Identical sequences A0A1L0DXB6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]