SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L1RV32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L1RV32
Domain Number 1 Region: 5-118
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.63e-27
Family Transglutaminase, two C-terminal domains 0.00021
Further Details:      
 
Domain Number 2 Region: 121-215
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.28e-22
Family Transglutaminase, two C-terminal domains 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L1RV32
Sequence length 216
Comment (tr|A0A1L1RV32|A0A1L1RV32_CHICK) Uncharacterized protein {ECO:0000313|Ensembl:ENSGALP00000062688} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN= OC=Phasianidae; Phasianinae; Gallus.
Sequence
MRNPGISGKFKLAEPPVFGKDINLILILNNLSTDHKTVKVDISASSVLYTRRAVAEILKA
NTSVDLGSKQGKHIRLKIPYAYYGKYLTTDKRIQVTALCEVMHMHGVKLLVEKTIILEDT
NIIIKIPRRVVVNKAATLEISYANPLPEPVDRCVLLVTLMNQQVKIHLARLAPRERSRIY
FEFTPRRTGPLQLQVDFSCDKFSHVKGFVTIAVQPA
Download sequence
Identical sequences A0A1L1RV32

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]