SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L3A6A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L3A6A8
Domain Number 1 Region: 72-311
Classification Level Classification E-value
Superfamily Lysozyme-like 2e-105
Family Family 19 glycosidase 0.0000000106
Further Details:      
 
Domain Number 2 Region: 21-64
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.000000000000327
Family Hevein-like agglutinin (lectin) domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L3A6A8
Sequence length 311
Comment (tr|A0A1L3A6A8|A0A1L3A6A8_CUCME) Family 19 chitinase {ECO:0000313|EMBL:APF47214.1} OX=1922203 OS=Cucumis melo var. saccharinus. GN=CHT-2 OC=Benincaseae; Cucumis.
Sequence
KTYSLIILSFAFLLGAASAEQCGRQANGALCPNNLCCSQFGFCGDTDDYCKNGCQSQCRG
SSTPTPSGGSGVGSIISESLYNQMLKYSRDPRCPSNGFYTYNAFITAARSFPTFGTTGDA
TTRKREIAAFFGQTSHETTGGXSTAPDGPYAWGYCFIRERNQQXYCTPSQQWPCAPGQQY
YGRGPIQLTHNYNYGPAGKAIGAPLLTNPDTVATDPVTSFKTALWFWMTAQGNKPSCHNV
ITGNWQPSSADNAAGRVPGYGVITNIINGGLECGHGPDDRVKDRIGFYKRYCDMLGIGYG
NNLDCYNQRSF
Download sequence
Identical sequences A0A1L3A6A8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]