SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L3I2J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L3I2J0
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily WGR domain-like 0.0000000235
Family WGR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L3I2J0
Sequence length 83
Comment (tr|A0A1L3I2J0|A0A1L3I2J0_9RHOB) WGR domain protein {ECO:0000313|EMBL:APG46325.1} KW=Complete proteome OX=1844006 OS=Phaeobacter porticola. GN=PhaeoP97_00895 OC=Rhodobacteraceae; Phaeobacter.
Sequence
MQIRLEKFDYHEGQHRYCVLSLSQTLFGEWCVEQINGPLGEAGGQQRRSYFTSRESALAA
AEKDRARHIKRGFVPIPVQLGLF
Download sequence
Identical sequences A0A1L3I2J0
WP_072504046.1.70083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]