SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L3Q1Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L3Q1Z9
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000929
Family Steroid-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L3Q1Z9
Sequence length 79
Comment (tr|A0A1L3Q1Z9|A0A1L3Q1Z9_9EURY) Predicted heme/steroid binding protein {ECO:0000313|EMBL:SDW67715.1} KW=Complete proteome OX=2177 OS=Methanohalophilus halophilus. GN=BHR79_04920 OC=Methanosarcinaceae; Methanohalophilus.
Sequence
MREFTPDGLAKYNGKDRDEIYVAYKGNVYDVTNSELWMAGDHQGMHEGGIDLTEEMEEAP
HEEDVFNEFDIIGIFVNNH
Download sequence
Identical sequences A0A1L3Q1Z9
WP_072561339.1.51233 WP_072561339.1.52505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]