SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L5XZH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L5XZH1
Domain Number 1 Region: 19-182
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 7.65e-29
Family HemS/ChuS-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L5XZH1
Sequence length 210
Comment (tr|A0A1L5XZH1|A0A1L5XZH1_9XANT) Hemin transport protein {ECO:0000313|EMBL:APP83628.1} KW=Complete proteome OX=90270 OS=Xanthomonas gardneri. GN=BI317_04965 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MTSARPLPQLSHARATRAALPRPQQLAALGTVLCLYRPALGNELDGWQHAVDAAACRQVD
SDGVRESIWFFDAEGHCCWRICLLPDSDFLIWDRLVSRLPPLPMETHELGVGERLWRRLA
GRMRGEAWRLSALRLQTAATREQPFVASLATVSALGAEVAARLAREEGIDGRVAVDDCCC
ARAAALRTASTTSSGTHPSDMTTSLVRLRR
Download sequence
Identical sequences A0A1L5XZH1 A0A248YAF6
WP_074056707.1.11469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]