SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L7VIE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L7VIE0
Domain Number 1 Region: 15-220
Classification Level Classification E-value
Superfamily eIF4e-like 1.44e-49
Family Translation initiation factor eIF4e 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L7VIE0
Sequence length 258
Comment (tr|A0A1L7VIE0|A0A1L7VIE0_FUSPR) Related to translation initiation factor 4e {ECO:0000313|EMBL:CZR39556.1} KW=Complete proteome OX=1227346 OS=Fusarium proliferatum (strain ET1) (Orchid endophyte fungus). GN=FPRO_04453 OC=Fusarium; Fusarium fujikuroi species complex.
Sequence
MSSRLPLFTRGIADSQSQENDPSSPAEQRDDAKRNFLKTMRALPTQHYWNVYFDRQAKEG
ESGDQYHSGLEQLGTQIESVQDFWRYANNTPVGNIGVRESLYLFKSGFRPVWEDRRNILG
GSWTFRFPKSIGPDVWTRVQLLAIGEKLQSVLDDDDQLCGVGLSVRFNSHLITVWHRDAS
KKNSIDNIVKCIMEELPPEMHPKPDAYYYKRHSDHAGFNPPPELKVVLDSRRQEEEKLAA
AAAKGGDAKPAVTVESPQ
Download sequence
Identical sequences A0A1L7ST24 A0A1L7VIE0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]