SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L7XH38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L7XH38
Domain Number 1 Region: 441-506
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000418
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L7XH38
Sequence length 521
Comment (tr|A0A1L7XH38|A0A1L7XH38_9HELO) Uncharacterized protein {ECO:0000313|EMBL:CZR64363.1} KW=Complete proteome; Reference proteome OX=576137 OS=Phialocephala subalpina. GN=PAC_14261 OC=Phialocephala fortinii species complex.
Sequence
MELAAAAGSAATVVQLVDFAGRTIKSTTSFFASVVSASKELEILRLRVQHLEQLFENTRA
LACSYQNTPLALEPQNQRTLDFLGHALTKCSVDLQELNCVLQKPVAQTDWGIVRMKRRVK
HVLDEATLRRLSARLQDNIGSLNSLLSGISMHNDSVIHGSIQQVAGFVQHLPQLSAQLSS
LPIESRLDRIDKLLEKLSLADNQLSTISTASEDEANETKSRSQATEYASSGFNAIGRFEV
AGVSSDELFPALELFAPAFRTGMQFLYRNRELQILKEAMSWVLSEFHELLADVHRAAAGS
YTHVLTDEDGSQINFGEALVPRRFYRKTEIQHKPSQHKQSKTIALPLSNTSLPNFKQDML
YADCEGFVMTNSGQLLARFEGTHSSEQWPLGESESGFVRISFVPKPSLKLPGIGIAFFKQ
SGDLDGTCHSFLTTFNILSPDAPILQAIKDGDRGVSKVLQKLKSGEHWAGDRDDQGRSLL
SYAIESGSRDMVALLFRMGAHPQDSHNFKQMQFVPMQHIRS
Download sequence
Identical sequences A0A1L7XH38

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]