SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L8ED02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8ED02
Domain Number 1 Region: 111-231
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.07e-33
Family cAMP-binding domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 233-359
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-30
Family cAMP-binding domain 0.0000029
Further Details:      
 
Domain Number 3 Region: 10-58
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.31e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L8ED02
Sequence length 374
Comment (tr|A0A1L8ED02|A0A1L8ED02_HAEIR) Putative camp-dependent protein kinase type i regulatory subunit isoform x1 {ECO:0000313|EMBL:JAV16526.1} OX=7368 OS=Haematobia irritans (Horn fly) (Conops irritans). GN= OC=Muscoidea; Muscidae; Haematobia.
Sequence
MANTLEEQQSLRECENYIQSHGIQRVLKDCIVQLCVSRPENPIQFLRQYFQKLEKEQVKL
DSTKQVTSPDDCEDLSPMPQTAAPPVRRRGGISAEPVSEEDATSYVKKVVPKDYKTMAAL
SKAIAKNVLFSHLDENERSDIFDAMFPLVHLMGENIIQQGDEGDNFYVIDQGEVEVFVNS
ELVTTIGDGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEE
FLSRVSILESLDKWERLTVADALETVTFEDGETIVKQGEAGDDFYIIVEGCAVVLQIRAE
QGDEPAEVGRLGPSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILK
RNITQYNSFVSLSV
Download sequence
Identical sequences A0A1L8ED02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]