SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L8EQL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8EQL8
Domain Number 1 Region: 118-239
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-33
Family cAMP-binding domain 0.00000106
Further Details:      
 
Domain Number 2 Region: 247-371
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.5e-32
Family cAMP-binding domain 0.000000777
Further Details:      
 
Domain Number 3 Region: 14-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 8.89e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L8EQL8
Sequence length 380
Comment (tr|A0A1L8EQL8|A0A1L8EQL8_XENLA) Uncharacterized protein {ECO:0000313|EMBL:OCT61559.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18047586mg OC=Xenopus.
Sequence
MAASSSSNLEDESLKGCEVYVQKYNIQQLLKECIVNLCIAKPDRPMKFLREHFEKLEKEE
CKQILAQQKSNSQSDSHDDEISPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKD
YKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVNHIAGEIVIQQGDEGDNFYVIDQGE
ADVYVNGEWVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLR
KRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGTAS
VLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGP
CSEILKRNIQRYNSFISLTV
Download sequence
Identical sequences A0A1L8EQL8
XP_018094652.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]