SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L8GHR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8GHR4
Domain Number 1 Region: 257-395
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-35
Family cAMP-binding domain 0.0000017
Further Details:      
 
Domain Number 2 Region: 122-247
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-31
Family cAMP-binding domain 0.00000147
Further Details:      
 
Domain Number 3 Region: 2-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000275
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L8GHR4
Sequence length 405
Comment (tr|A0A1L8GHR4|A0A1L8GHR4_XENLA) Uncharacterized protein {ECO:0000313|EMBL:OCT83381.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18025923mg OC=Xenopus.
Sequence
MSIEIPPGLTDLLQGYTVEVLRQKPPDLVEFAIQYFTRLKEKQLQDGAGAGAIRPHTRVV
NFDGEPMQTDSNGEEEEDDEEEDDDSDFEPPVINRYSRRVSVCAEAYNPDEEDEDTEPRV
VHPKTDAQRCRLQEACIDILIFKNLDQEQLSQVLDAMFERRVEPQEHVIDQGDDGDNFYV
IDRGQYDIFVQRDGQSRCVGKYDEHGSFGELALMYNTPRAATIVATTEGALWGLDRVTFR
RIILKNNAKKRKTYEIFIESVPILKSLELSERMKIVDVIGAKVYKDGDRIIAQGDQADCF
FIVESGEVKIMMKSKTKTGQESNQEVEIARCKSGQYFGELALVTNKPRAASAYAVGDVKC
LVIDVQAFERLLGPCMDIMKRNITHYEEQLVALFGSSMDLRDPGK
Download sequence
Identical sequences A0A1L8GHR4
XP_018116896.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]