SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L8HID6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8HID6
Domain Number 1 Region: 17-117
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 5.39e-36
Family Inhibitor of apoptosis (IAP) repeat 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L8HID6
Sequence length 160
Comment (tr|A0A1L8HID6|A0A1L8HID6_XENLA) Uncharacterized protein {ECO:0000313|EMBL:OCT95844.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18013534mg OC=Xenopus.
Sequence
MYSAKNRFVQSVQRLQDFRNMYDYEARLATFADWPFTENCKCTPENMAKAGFVHCPTENE
PDVACCFFCLKELEGWEPDDDPWNEHSKRSVNCGFLSLTKCVNDLTMEGFLRLEGDRIKS
FYRKFSTVVLQYVEEEMTAATKRLLEYFSNQHQCSIDLDH
Download sequence
Identical sequences A0A1L8HID6 Q4R1J6
gi|68163353|gb|BAE02678| gi|82250031|sp|Q4R1J6|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]