SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9AN71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9AN71
Domain Number 1 Region: 121-150,224-293
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000955
Family Pseudo ankyrin repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L9AN71
Sequence length 1275
Comment (tr|A0A1L9AN71|A0A1L9AN71_9RICK) Ankyrin repeats (3 copies) {ECO:0000313|EMBL:OJH31445.1} OX=77039 OS=Wolbachia endosymbiont of Armadillidium vulgare. GN=Wxf_00836 OC=Anaplasmataceae; Wolbachieae; Wolbachia.
Sequence
MLALYTMSFSYVVGYFMVSWFRLMSISNNEIFKNKIEGKLGLKLPGDLGCFKEKYNKYLI
LFENLTFEQLIYQEEDESPLFCYLLFSEKLLSPEKVGILFNKVKSKQGVDWCTKLKNGNS
LLHHAFMHREYVAIHAIIESDPETMNVKNSEGLTPLDLINEKAVDKFFEVFSKKTKTGNS
CESRRVSEAFFQSIFDRLIRFSECQTTVKKLLKIKSIRVEQWGRALVEAARIGNKSIVES
ILDVHKEFTKMQKSSEIGASAITEAIRNNHPEVVSSLIKNNVAFDSYYTLVKEAIKSCSD
QIMSVVLFTGPYEEKIREIISQDVKGKVKIKKTSLKQITNVNGFLQKCLEKRNIVSYLCS
VQKAIKDKEFYFDTSWLSQFGLLDEKASQSICQDILGYIQSLEKACGVQLIYNNFLSDQE
IQELICFVRETQDQDEECRNRIISFLEEEATERGIRLVPLSPDSGITLSANSSIGSLGNY
AGRNLGDTYMNTEELHKLLDDAFYDGTSELESYFNRYKNQLLDLLTESFKHCCGWHLKSE
EKWDALPLIDYILKKAESNYDKCKLITSPLCSAYLLHGSTKCDNPLLTDGVYNSEDFRRV
AFSKLQSVRELIGKGSDYNIIDNFLADALISVLQGKHGNAGHKRLCLELFHKDIVENGFE
PHKIFSYAITNTICHHKFFLMNCEYFERFCPKNAESVLSSAFSQAVNFGRLRCLTKLVEV
MNNLRVDKHKMYGVIFTTLLNRYDDKEFKLLKKVMYLLEKESKDFKLQVFIDACTSAMSR
KNNAFCIYLLEQKGTQEFAPVLLERALAIAILKVLPNAIDDLLNAKIKGLKLSNHSELLL
YALQLSIQHKSADCMGVVLKKAKELESDDYLNLLLSVLKITINLGASNCIGPLLKEFKDL
KLDYNDCKVKDKIMNTFITSIYQENYDLCGEVIAFLLSEQKVSNEMTSLFFESLSKLSDE
VLLGIVNSMIEEISSPPSQLEEEALLACLKECFKHNLLQPRHIESVIGFHKMYVKGNSVP
FFKEVLIHAIEGNNLLSFSSSLDAILEKIDNSDEVLQLLDATSQATLKAEKHIMHRYLTE
KKLEIYPKTYADTQMIEGIQNSQSNVEKTRLTQTEDEIIQLQESGCIIDSKTKEFRKKCE
ELLVLYKVPDALYDFYLRRVSELFEKFCTKPKNRSPDLGIRELLKECMLEVFEANTLPDY
VFVFSKVRSGELKKEGGRTAVSSVKIILSKIQDIFNKLLEDLIPPQVGYISPLQEDCSSC
LQNVVVATSNNNISK
Download sequence
Identical sequences A0A1L9AN71

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]