SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9C656 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9C656
Domain Number 1 Region: 6-79
Classification Level Classification E-value
Superfamily Pre-PUA domain 7.85e-21
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.0013
Further Details:      
 
Domain Number 2 Region: 82-156
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000000000000265
Family PUA domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L9C656
Sequence length 159
Comment (tr|A0A1L9C656|A0A1L9C656_9EURY) PUA domain containing protein {ECO:0000313|EMBL:OJH49946.1} KW=Complete proteome OX=523843 OS=Methanohalophilus portucalensis FDF-1. GN=MPF_0740 OC=Methanosarcinaceae; Methanohalophilus.
Sequence
MAMTKEESRIKQVRTMADYQFGKGCGNILFSGEITFKLSRTKRIRQIFSGGKRMATVRAR
DGMFTLSIEGASLIHSHLPIPGYRVMMCEDAIPFVSKGKTAFAKHVENIDPDLRAGDEVL
LVDKQDNLIATGQLLLAPEEVLAMQNGPAVDVRVGVDSS
Download sequence
Identical sequences A0A1L9C656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]