SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9MY91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1L9MY91
Domain Number - Region: 541-652,691-746
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0034
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L9MY91
Sequence length 1070
Comment (tr|A0A1L9MY91|A0A1L9MY91_ASPTU) Uncharacterized protein {ECO:0000313|EMBL:OJI81988.1} KW=Complete proteome; Reference proteome OX=767770 OS=Aspergillus tubingensis CBS 134.48. GN=ASPTUDRAFT_151353 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MIRLLPNHDKDKDAEIECELFNYDLTSRSGADSHLYEALSYVWGSSTRSRTIKLNNCAFP
VTENLYLALSRLRNRQLERTLWVDAICIDQSNRDEKAKQIPLMRTIYAQAQHVIVWLGEA
YENGDKALEALRCLAEGQDVDIRGCGALCVKLFERAWFRRIWVLQEVGVALHIYIMCGSA
QINGYAFCEGLKRLDRHLDCQELIGPVAFLIKGALVRPKYEPGSRGTLTIGELVGMYCYH
NATEKHDKIYALLGLSADPMTPALTPNYVLPWNQVFKQVTNYIFPDCSVETWPGSDIVII
RGKGRALGHICSVQRVSDFGQQKVKVYLNDTARSIGYESEWEASWELQTFAQTFKPGDII
FLLQGDSKPSVIRLCKDHFRIITPAVTLCKRRPRESPEGTSRRWHTLGGSCDILLAWRIP
LNNDTRSQKWPETELLDMVPAYQGQSLEAEYRRNNITRIMASVAMGALALKKPEDKDIAH
LLATSGTDDSIASRLTKASAKDIRCFPDKRLQIFFPCEQDDLSISEEMVKSVAENIGPCG
YIIIELLFQLQGGNLPISEEVVEAAARNSGDYGHLVMKTIYRHRGEFFPISEKAVMAAAG
NTGKRGTKLLKLLFKSQGEALPVSEEVIKAAAMSDEICGHEIFKIIVRHGDKHLLVSEEV
CKSTMGNTRWGDKNLRYLVENWERKVHISEGLLIAAARNNIWGHTILEILFQHGEASLQM
SEEVLEATSRNNFGHRILELLFRHGLKTPPISEEVIKAMAGHLGGELMLELLFQYTEEKI
LISEDVVKEAAGNRMVGDRVLHLLFQKEGNRLPVTEEVVKTAAGNYHGHSQLKLLFQHRG
VSLAISEKVVEAAAGNGDNGHAVMELLFQQKGEKLPVTEEVVKTAAGNDHQGHKIMECLL
QQKGKSLPVTEEVVKRATGNELCGDYMMELLFRQRGEKLPVTEDVVKAAAGNEIRGDRIM
ELLFQQRGERLPVTEDVVKAAAENLRCRSYIMELLFQQRGGILPVTEEVSEAAAEDTCCG
STSNSEIPESAESAESAESSDSSDSTDHSQSSARPESSENLLSWFGMVGK
Download sequence
Identical sequences A0A1L9MY91
jgi|Asptu1|151353|estExt_Genewise1.C_6_t20422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]