SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9Q187 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9Q187
Domain Number 1 Region: 1724-2005
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.8e-80
Family Sir2 family of transcriptional regulators 0.00000265
Further Details:      
 
Domain Number 2 Region: 1198-1417
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.42e-17
Family Ankyrin repeat 0.00087
Further Details:      
 
Domain Number 3 Region: 163-346
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000746
Family Ankyrin repeat 0.0053
Further Details:      
 
Domain Number 4 Region: 721-832,896-934,1001-1043
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000785
Family Pseudo ankyrin repeat 0.03
Further Details:      
 
Domain Number 5 Region: 321-548
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000071
Family Ankyrin repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L9Q187
Sequence length 2069
Comment (tr|A0A1L9Q187|A0A1L9Q187_ASPVE) Uncharacterized protein {ECO:0000313|EMBL:OJJ07486.1} KW=Complete proteome; Reference proteome OX=1036611 OS=Aspergillus versicolor CBS 583.65. GN=ASPVEDRAFT_141900 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPQSGRDEGWLRAWCTKHDIAADEFQPQLPLISTYSLSTQKEDEDQANLLLTQASEIRRT
GESKTTTVPGKVKKDKWSYEDYCGVLTEIVNASGSVGVAESVWNSLQLQKPKKARTGRFA
RRQQAGDEETDDLLFLLLCSTMRYKETAMFHFLANSASSDVVNRMLPTALQMRSQRNTQI
LLEENADPNTCSEEFITLVRAGDDEFVRLLLQSQTPIDIAILTSALPDAVQRGNIGVVQL
LLAHGADANSDSGIAMEKAIRAKRTDLALLMLMSPNPPLPETLAPIVSYVFFKMEILQDK
KYSLIELLLNGGATGGSVSLALGGAVLQRWTEVVELFIDKGVSINYNKAEAYRHAVHQVD
LEMLRILSRGKLDDDLASELFGEIDQTKYGSSITNEKWHALAELLLDQGAAGDVVDEALN
QRVEKRDLAGVNLLLREGASVDYANAAALDKAVASENEEFIDALLQYQPAAQSVNTVFDR
VDRLSPDVKLRITRKLLDAGANGTAVNDILKNAMTQHTGERDREFIQILVDGGADVGQGK
GYLLQLAVQSSDDATLQILLLGFPVPTILSSCIPLAIDLTETQRYKIIHMLLHAGARGDE
VSQALVDSIDGTSSGCQLASLLLATGEANTGFESGRAFKKAIESPNIDFIELLVQYNHLQ
ESDFCASLLVAIGLLQRDRTRLEKIRILLMSVQELSGGTGHAALRHEMEGLKRRDDQTLG
VLHMLLEAGADVNHNQGRVFVDAIELGLFECFKLFLATHPSFQSLENAFENALSIALRAT
LPLDLRYLQELLATGMPQAALDKALLRTTEERNEVLALLVLRHGASVNYQDGAAVRHAVS
KIDLELLAHLLRHDPAAVTLNCGFAKAMTLHDIRAKHDCYQLLLKAGPVSQRLLEEALVA
SADGGWMHAAICELLLNHKATPNYAAGSPLCRAIRSANYKVDLIKLFLRYRVTEEAVAAA
LGAAFETLQGETRIATMDLLLATQKPQLTLDQLLLKSVHAPHCDHKLIQCLLKANASIFY
QGGECILHAVMINDIQTLRILEPYLHGHSGVSEIFMTVWGNGKRANSPQEEAVLSLLVCA
GASGEAVDMALLETVKTVSTTPSGFAFIVNLLNAGADVNYCEGACLVEAATQANVHIIKE
LLAYGPRRSNTTRAFPLVFRSGVDAQSLREIAVAFCSHSSAPDLTYDHPTCGPVLCLMLH
TYPNEAELLQYLIDKGSVVDPVVKATLPLSPSEEKVSLLCWALAQSKAALREDVVEILIK
SGADVNFQAALSQSTPLQLAIVGSRAQSVAALLQFHADPSLESNGISPLSLAASIGDTNI
VRQLVNAGAAPGDGSLHEAARMVNVSVLQVLLIEAKQRDYPCSRFQGRTALAELCMTAGN
KPTSQLKAAMSLLKNNGDFRRKSKGKSVLHFALDHPNAILVSQALLDVFMSEYVNDDFNV
FEDGRYRYSPLAYVSRGLNKAPPTQRTGLTDLLLEFECRDRFWAAEGEQPVDMVGAPEEI
MRVLKTQKQRQARIQEEDEDHERRLMRRRAEQAEELSSLRARHNLTLDHTREIASETARL
EHETASRQATIASQRYDAELSYMRQVTDLANRRKDDSNYREIEHRRQLALMENSQRDESY
NIEKQRREEEAAFVQHRERLLTSGYEDRARIDRDRYAEQMRLFDAQKGIMEMNARPKVVK
QIAYEADSSIHVSNRPGINAFYPPLCLSFHPIPSFHPLHNHIKNTKRHKMTTPQSDIDTI
CTAIKSGTIKSIVILAGAGLSTSAGIPDFRSPETGLYARLAPLQLPYPEAIFHISYFRHT
PEPFYAIAAARHPRNLKPTLGHAFLALLDRKGLLKFVFSQNIDGLEVDAGVERGKVLNVH
GNWQSQRCFKCKVPYPDGDMRRAVKLGEVPNCPVEGCGGVVKPDIVMFGESLPQAFEDKR
EEVIPQADLMLVLGTSLKVAPASGIPRLVKEGVPRVLVNNEVVGDFGSRGSDVCVLGSCD
EGLREMARKLGWEGELDSIWREAVERKERVVKSEGWDEEGPSLDECIQKAADRMKLRMGV
SDGHRRMLEGHLGEKMAGILGRANRDQPS
Download sequence
Identical sequences A0A1L9Q187
jgi|Aspve1|141900|e_gw1.13.128.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]