SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9RZ75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9RZ75
Domain Number 1 Region: 272-406,453-508
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000927
Family Extended AAA-ATPase domain 0.064
Further Details:      
 
Domain Number 2 Region: 753-833,1002-1075,1108-1135
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000721
Family Ankyrin repeat 0.007
Further Details:      
 
Weak hits

Sequence:  A0A1L9RZ75
Domain Number - Region: 1136-1197,1347-1413
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00157
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L9RZ75
Sequence length 1506
Comment (tr|A0A1L9RZ75|A0A1L9RZ75_ASPWE) Uncharacterized protein {ECO:0000313|EMBL:OJJ40118.1} KW=Complete proteome; Reference proteome OX=1073089 OS=Aspergillus wentii DTO 134E9. GN=ASPWEDRAFT_144532 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MFLRLCAKLNFTKSDRRDGEKHDEQPPRPNTQVQNRVMKKADVDVSSTQDTKASKHPREN
LWEIAGERLDDKYRKFLDLDSPLPITKAIEDVIESTEKKYREYKEGGLKIRKRHGGHINV
RDSAKNIIRYALQAQDLVKTIVSFDPTGHASSAWSIVSIGLTMINNAIERRDDIFEASEY
LASTLFYYAIVDSHYLDRKVESDQGLEDSLVEVYTAVLQYTAEVKKAEKESAAARVGKSI
AALVQQPLKDLKAAIETKGEAVQKWTDLTATLDHRQQAESTLDRIDEAVERLKIIQSHQR
SLQDREILDWLSTTSYSDPQNNTQDRRASDTGNWLLELAEYKEWKTTAGQILWLHGAVGC
GKSVLCSTVIKDVEEFCYADPSRNFAYWYFQFSNEETQKVYNMIRSILRQFMPRTLPASM
IKLWEGHSNRGSKPQQQKLVDILDIIIENFQGEFFLVFDALDECPATGHAERSFLLESLQ
GLMAKHPSKMHILATSRPEPDIRSKLEKYQNVNLEIGLVEDVETFVRAQVSHGRLCEWGA
SIQKQILEKLLDIPERRRFRWADLQIKRLEESRTEAEIHNALGSIPQTLEDTYKDTLERL
SSYHREAARTILIWLSFSAVPLDLKTVAAVVSFRFPEDVVTTCTTSLVTVSTSDDTVRLA
HFSVKEFVDRKDTEGQWYQFSAISGHDAMANKTLDCLLDTTEILTKTTAMQQPLLIYAAT
YWDWHLEELGDLYAKRTGLQEKVDRLFTERDIYFNWVRLLHYYSDYSWGQTFEELDPPLY
YASDKGLKTTVETLLAKGAYPSKLRSDGSKNPISAAAEQGHLEVLKLLLEKVDEIPRRVT
EGILESTNTPEADKEKLAVILDMLWDKGALHDQSRASRKIIDERLVGTAAGSRRKSGPLL
MSLLLDRKEKMTVKITEKVLRAASLNLICGTEIMKLVLNRCDGDIKITSSFMQELISSSS
SSPDFMTVVLNRRIDEIMLDEKYVESFARGKKEAMELLLQKRGEEIQVTEKVLIAAARNT
HDAQTVRLLLIRREPGTNINKEILISAARNRRKGSEIMNMLLDEFGQDTAIDDEIIQAIA
ENPDEGLDMMKTLLCRQQAWVGVSEQILDKAATWNNREMLELLVNNARGSDIAITEKIVC
SAAQNNDHAVELMEYLFDLRGHSLPITEDVLVSAATAQYYQSRSDDLLTLILERRPEMPV
TDRLLEAVSPFPNAIKLLLDRRQDRLPIGKMIKNISTGYNKQPRVQELLLDRQLVQVDEW
LVETVAGNSLAMKVIYIRKPEFPVTPKAVLNAAVDPNSLHTLLIRQKNQILITEQVIKAS
LQDTMPECAIDLLLTRLGPAAVPITEDILIYAIRNGRIMALELLLEQRRDLNLEAVWEAI
WQVTELNPYYLTEATGVLFRYAHFDISEMMLEKIPSVSMDEGFWVYPFDGLIRSCLQHRI
PLPTTETAFELIVERASVNTIDIFLEDHPDMETTEKHIQAVGRNPRENVDKDDLVSLLLS
KKPNVF
Download sequence
Identical sequences A0A1L9RZ75
jgi|Aspwe1|144532|estExt_Genewise1Plus.C_1_t10236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]